PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0023s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 891aa    MW: 88709.3 Da    PI: 6.7117
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0023s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK61.51.4e-19773817852
               RWP-RK   8 edlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          e++   F+lp++dAA+ Lg+++T LKr+CR++GI+RWP+Rk++sl
  Vocar.0023s0090.1.p 773 EQIYGTFDLPVADAARVLGISATELKRRCRRLGISRWPQRKLQSL 817
                          678889************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.79750837IPR003035RWP-RK domain
PfamPF020421.5E-17773817IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 891 aa     Download sequence    Send to blast
MSSSRTGFSS HGSCPGIAHQ FFNFCDPPSR QHAAFVNAKG DCVSGPAPYR KNTWPSAAAP  60
ETLSLPHDHS RAIAATISVK SNAGAAATMP VSQLPPHAAA GVDPYQCCKP PQAPAWDPYP  120
PPPQSLSGMV GRLARSGALA AHPHLHACYG PPASVMVPLP PTAARPPLAP RPPAGAAPRS  180
GGQAHGPVGM PLSSPSPSHQ HQVYPHQPMP PQAGSGAHPV APPAPSGTYP VSVPTSVSAP  240
PPPPGVWPWP WSLSQPPPPP PPPPSAAPPQ AGSGGGPVTG AGGNGSSGAS GWTASGPPGG  300
GGSGGGAVGG MCRSGGGSGG SGGWRPEDDE AEDALQELLL EEIAAAPWPH VHIPSLRAAG  360
IFIETCHGGR CDPTLMPPWP LPHLSGATPP SMPPWVTGAG ANAAAAMAAK QSTAAWDPMQ  420
MPPPLPPPMP AQIPPQPHLQ QQQHQQQQQL SPETSTLPHM APPLPPQLSP QQKHLTQSQS  480
ANPPQELLLP QLQSQAATDG LLLGPPPISA GGTGMMDVEI GLQSRSDDAL FAAWLSEMGT  540
GAGAPQAPPG MTSAGSGSGG AAVCWAPPGS TTLTGPTGTA PPPPTGAGAA QQDSGYNRAS  600
FVNSPNSTSM PTTPTVTNGR PRSETGCGGG FTLSASASAA ATAPSQTAAA AAAAAAVSAA  660
VAVVAVVEAA ADAADAAAAA NAAAACGGGD GVVRVEEAML SDDGEAETVS GGLNAAAAAA  720
AAAAGGAIGA GAHTGVVPAS TIDGSWDGGA GANTGNCAVI GGGAHTVAAS LREQIYGTFD  780
LPVADAARVL GISATELKRR CRRLGISRWP QRKLQSLRRI VQAAESDAGL SEDERKAVIE  840
LAARNREEIM ADPDAPLVDL LKTVRQTQYK QSFEKRAAAA AASRRAPPPM *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002952004.11e-155RWP-RK domain transcription factor
TrEMBLD8U0321e-155D8U032_VOLCA; RWP-RK domain transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-14RWP-RK domain-containing protein